PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRAES3BF104600030CFD_t1
Common NameTRAES_3BF104600030CFD_c1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 604aa    MW: 65992 Da    PI: 8.2351
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRAES3BF104600030CFD_t1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.45e-1666112148
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                              +g WT +Ede l +av+ + g++Wk+Ia+ ++  Rt+ qc +rwqk+l
  TRAES3BF104600030CFD_t1  66 KGGWTLQEDETLRKAVETFNGRSWKKIAEFFP-DRTEVQCLHRWQKVL 112
                              688*****************************.************986 PP

2Myb_DNA-binding63.63.9e-20118164148
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                              +g+WT+eEd++++d+vk++G+  W+ Iar ++ gR +kqc++rw+++l
  TRAES3BF104600030CFD_t1 118 KGPWTQEEDDKIIDLVKKYGPTKWSVIARSLP-GRIGKQCRERWHNHL 164
                              79******************************.*************97 PP

3Myb_DNA-binding60.53.7e-19170213146
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                              +++WT+eE++ l++a++++G++ W+ Ia+ ++ gRt++++k++w++
  TRAES3BF104600030CFD_t1 170 KDAWTAEEEQALINAHREYGNK-WAEIAKVLP-GRTDNSIKNHWNS 213
                              679*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.68461112IPR017930Myb domain
SMARTSM007178.1E-1465114IPR001005SANT/Myb domain
PfamPF002491.4E-1466112IPR001005SANT/Myb domain
SuperFamilySSF466893.23E-1567122IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.8E-2168124IPR009057Homeodomain-like
CDDcd001672.06E-1269112No hitNo description
PROSITE profilePS5129431.783113168IPR017930Myb domain
SuperFamilySSF466891.58E-32115211IPR009057Homeodomain-like
SMARTSM007178.5E-19117166IPR001005SANT/Myb domain
PfamPF002491.8E-18118164IPR001005SANT/Myb domain
CDDcd001679.42E-17120164No hitNo description
Gene3DG3DSA:1.10.10.602.0E-27125171IPR009057Homeodomain-like
SMARTSM007171.3E-18169217IPR001005SANT/Myb domain
PROSITE profilePS5129424.45169219IPR017930Myb domain
PfamPF002491.8E-17170213IPR001005SANT/Myb domain
CDDcd001673.30E-15172215No hitNo description
Gene3DG3DSA:1.10.10.607.9E-25172219IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 604 aa     Download sequence    Send to blast
MGAMAEAEHE GCVENRQPLA ASSESVSEGS SYGGAGGPAR MSPPVSGSVN SISGLRRTSG  60
PIRRAKGGWT LQEDETLRKA VETFNGRSWK KIAEFFPDRT EVQCLHRWQK VLNPELIKGP  120
WTQEEDDKII DLVKKYGPTK WSVIARSLPG RIGKQCRERW HNHLNPDIRK DAWTAEEEQA  180
LINAHREYGN KWAEIAKVLP GRTDNSIKNH WNSSLRKKLD VYGTRNILAI PRLVGHDDFK  240
DKQKPVASEG HLDLNTVPGI TSKNLPEIAH HSNFSSHLQS YKLDHAKAGS GFLSISFLPT  300
VQPLTSSEVS SVVNGSAVTL AAQGLESDSV RDKALEIVSV HEKGLKVDST LDTLREPGST  360
QLEAVPAKGE ESSLKNDAQS SLGPLCYQIP NMNDVAPASS SLFSEHQTVH QTSEHCRNGA  420
LSPNGCTTPT KGTMSVQLSV DSILKIAADS FPVTPSILRR RKRERPTPAS DLKFGEPNTD  480
SFYTPAGKRP TTDTPESFRT ASFLSLGSLD GLSSSARGFD VSPPYRIRAK RMCLTKAVEK  540
QLDFSSNGLG TCGSEVLNSP HQNSQSTHSL GEASIMKEKE LNGHAIQLET QTKNIAYTTN  600
MDVT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C3e-73652195159MYB PROTO-ONCOGENE PROTEIN
1h89_C3e-73652195159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00482DAPTransfer from AT5G02320Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHQ2364940.0HQ236494.1 Triticum aestivum MYB3R transcription factor (MYB3R1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010232544.20.0PREDICTED: myb-related protein A-like
TrEMBLA0A077S4V40.0A0A077S4V4_WHEAT; Uncharacterized protein
STRINGBRADI2G54640.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP30993880
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02320.21e-108myb domain protein 3r-5
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]